(data stored in ACNUC7421 zone)

EMBL: CP001958.PE75

CP001958.PE75        Location/Qualifiers
FT   CDS             51744..55466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0075"
FT                   /product="Phage-related protein"
FT                   /note="KEGG: ami:Amir_3249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96568"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P1"
FT                   /inference="protein motif:COG:COG5412"
FT                   /protein_id="ADG96568.1"
FT                   /translation="MATNLSDVYVTIIPETRRVGEAIRAAFRDAEREAKLSSERMGRDL
FT                   DRELGDVHVTVKVGADTKRARREVDELKTHGQRAGEAMGTATGLAFGKMFSAQLGLVKF
FT                   ASLGAAGGLALSGLGGSLASIVGVASRASGALALVPAAAMGAAASVSALKLGVSGLSDA
FT                   FKAMEDPQKFANALQKLSPAAQESAKAVYALKPAFDSMKNTVQDSLFAGLAPQITQLGR
FT                   TYLPVVQQGFAGVAGAANQAGKSVAAWAQTPEAVGQVNKLLGNTTAGMNILATAARPAV
FT                   QAVLGLGAAGSDSLPRLSQAVADVSNRFAGFVKNASESGRITEWIDAGLTSLTQLGHAI
FT                   GAVGSVFATVFKAGSAVGGGMLGTITQVADKFNDFLKSADGQAALSGFFTGISQAAAAL
FT                   APILGTLAQIVGTTIVPALSNLGTAVAPALNGMLQGLGAGLNAIKPVFEQLSGPLSQIG
FT                   QVIGDVLAKTLPILAPALVPLAQAFADLLSAIAPLIPPIAQLASMFVQAVAPALSVVFQ
FT                   ALAPVIQQLMDALKPVLDQLGPVLAQVAQTLAGLLVQAIQELLPPLMPLVKSFADFLAA
FT                   VLPLLPAVVKVAAVIAGALVKAMAATLPLAVSVVKAMVDFSTKIANFVVPWVSKLADGF
FT                   GWLGDKVKSLIGWFSGVKDAAGEASGSVSSFASATPAPFAFPQTSGGVPGGGEPSALAN
FT                   RLRRSAGTPEGMDRAEAGRLGQSLAASATPDANGSLLADASRLLADYATGKGDQDAVAR
FT                   AAELIDQASKGGAYVPDSDPPPPAVPLPPVPAPLPVPAAPVLPAPSAGKGGKAPALAPI
FT                   TMADLDKYDTPGLETGAPVTVAPGSPARAEQSVPATMGVDVYTGMGQTGGGSGAQQGID
FT                   FAHSMTGTAYSQQVFGRIGIDCSGMVSATVNAAEGKDPFSSRMSTVNEGEWLKAHGAVE
FT                   GMGGPGDLSIGWWNKGSSGGNNGHTALTLPNGENVESGGSHGVVAVGAGAAGAGDKQFD
FT                   HHMHIPKELLGSVPTAAGYAPALSGASGDWRSRTADRAVQNAQDSVKDHQWRVDQAKRR
FT                   MIEAKTQQQRDMAEHALIVAERELAKSHEKLRDAQDKRAETMAKARQKGQRGGSDGAED
FT                   FGHSLVSGALSGLGLDGSLLDNPLEWSGVKWLTSMVNGFTKPAQGQQGRYGSDGAALPG
FT                   FGPPASDPAQLASLGAQGLSQGFGADSGSQPSPAQVDQSINLTGQFGNPNDTARAMRAE
FT                   MDNRNRAFSMNAGRM"
     MATNLSDVYV TIIPETRRVG EAIRAAFRDA EREAKLSSER MGRDLDRELG DVHVTVKVGA        60
     DTKRARREVD ELKTHGQRAG EAMGTATGLA FGKMFSAQLG LVKFASLGAA GGLALSGLGG       120
     SLASIVGVAS RASGALALVP AAAMGAAASV SALKLGVSGL SDAFKAMEDP QKFANALQKL       180
     SPAAQESAKA VYALKPAFDS MKNTVQDSLF AGLAPQITQL GRTYLPVVQQ GFAGVAGAAN       240
     QAGKSVAAWA QTPEAVGQVN KLLGNTTAGM NILATAARPA VQAVLGLGAA GSDSLPRLSQ       300
     AVADVSNRFA GFVKNASESG RITEWIDAGL TSLTQLGHAI GAVGSVFATV FKAGSAVGGG       360
     MLGTITQVAD KFNDFLKSAD GQAALSGFFT GISQAAAALA PILGTLAQIV GTTIVPALSN       420
     LGTAVAPALN GMLQGLGAGL NAIKPVFEQL SGPLSQIGQV IGDVLAKTLP ILAPALVPLA       480
     QAFADLLSAI APLIPPIAQL ASMFVQAVAP ALSVVFQALA PVIQQLMDAL KPVLDQLGPV       540
     LAQVAQTLAG LLVQAIQELL PPLMPLVKSF ADFLAAVLPL LPAVVKVAAV IAGALVKAMA       600
     ATLPLAVSVV KAMVDFSTKI ANFVVPWVSK LADGFGWLGD KVKSLIGWFS GVKDAAGEAS       660
     GSVSSFASAT PAPFAFPQTS GGVPGGGEPS ALANRLRRSA GTPEGMDRAE AGRLGQSLAA       720
     SATPDANGSL LADASRLLAD YATGKGDQDA VARAAELIDQ ASKGGAYVPD SDPPPPAVPL       780
     PPVPAPLPVP AAPVLPAPSA GKGGKAPALA PITMADLDKY DTPGLETGAP VTVAPGSPAR       840
     AEQSVPATMG VDVYTGMGQT GGGSGAQQGI DFAHSMTGTA YSQQVFGRIG IDCSGMVSAT       900
     VNAAEGKDPF SSRMSTVNEG EWLKAHGAVE GMGGPGDLSI GWWNKGSSGG NNGHTALTLP       960
     NGENVESGGS HGVVAVGAGA AGAGDKQFDH HMHIPKELLG SVPTAAGYAP ALSGASGDWR      1020
     SRTADRAVQN AQDSVKDHQW RVDQAKRRMI EAKTQQQRDM AEHALIVAER ELAKSHEKLR      1080
     DAQDKRAETM AKARQKGQRG GSDGAEDFGH SLVSGALSGL GLDGSLLDNP LEWSGVKWLT      1140
     SMVNGFTKPA QGQQGRYGSD GAALPGFGPP ASDPAQLASL GAQGLSQGFG ADSGSQPSPA      1200
     QVDQSINLTG QFGNPNDTAR AMRAEMDNRN RAFSMNAGRM                            1240
//

If you have problems or comments...

PBIL Back to PBIL home page