(data stored in ACNUC7421 zone)

EMBL: CP001958.PE78

CP001958.PE78        Location/Qualifiers
FT   CDS             58500..58751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpi:BPLAN_456 DNA-directed RNA polymerase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96571"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96571.1"
FT                   /translation="MDDEEEVKALEAACRAVPLASGAVLDLRLFAKEIAEHLFAEGCRK
FT                   RAERVEREFPERFLAVPDKLLGGWSQPCEVVDKRSEER"
     MDDEEEVKAL EAACRAVPLA SGAVLDLRLF AKEIAEHLFA EGCRKRAERV EREFPERFLA        60
     VPDKLLGGWS QPCEVVDKRS EER                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page