(data stored in ACNUC7421 zone)

EMBL: CP001958.PE81

CP001958.PE81        Location/Qualifiers
FT   CDS             61144..62403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0081"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="KEGG: rha:RHA1_ro08409 glycosyl hydrolase; PFAM:
FT                   glycoside hydrolase family 25; SMART: Glycoside hydrolase,
FT                   family 25 subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96574"
FT                   /db_xref="GOA:D6Z9P7"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P7"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ADG96574.1"
FT                   /translation="MTDPYGLPVGSDVRQGARGFPEWVYALGAAFGLDASTYPGHQERA
FT                   GLNQGIDWWPKGRADMTGASYTPAQRLALGRFALWAGTQPGVEQVIWCDPVSGVKTGFF
FT                   MGERVGPGTAQPGYYRDDWSGHTGHVHTRIVRALAAPDDIGQEGNSMPLWGVDISNNNG
FT                   AVDLAQVKAEGFDFVAAKVTEGTGFKDSYWPRNRDAARANDLILIGYHYVRDGDAEGQA
FT                   ANLAAHIGDTSVPVALDFESGSGGYANFQAVKSAVERRGMRVALSYIPRWYWQRIGSPD
FT                   ISDAPGLWASAYVNGTGYASVLYPGDEWSGWQPYGGGEPKILQFSSSAHVAGKSVDVNA
FT                   FRGAREELLSLLGATAPAQPTASLDQLVLDQLVGPGFHGWPQLDNKSVVDFLASWREEQ
FT                   RTANKAMADALALLLKGTTQ"
     MTDPYGLPVG SDVRQGARGF PEWVYALGAA FGLDASTYPG HQERAGLNQG IDWWPKGRAD        60
     MTGASYTPAQ RLALGRFALW AGTQPGVEQV IWCDPVSGVK TGFFMGERVG PGTAQPGYYR       120
     DDWSGHTGHV HTRIVRALAA PDDIGQEGNS MPLWGVDISN NNGAVDLAQV KAEGFDFVAA       180
     KVTEGTGFKD SYWPRNRDAA RANDLILIGY HYVRDGDAEG QAANLAAHIG DTSVPVALDF       240
     ESGSGGYANF QAVKSAVERR GMRVALSYIP RWYWQRIGSP DISDAPGLWA SAYVNGTGYA       300
     SVLYPGDEWS GWQPYGGGEP KILQFSSSAH VAGKSVDVNA FRGAREELLS LLGATAPAQP       360
     TASLDQLVLD QLVGPGFHGW PQLDNKSVVD FLASWREEQR TANKAMADAL ALLLKGTTQ        419
//

If you have problems or comments...

PBIL Back to PBIL home page