(data stored in ACNUC7421 zone)

EMBL: CP001958.PE82

CP001958.PE82        Location/Qualifiers
FT   CDS             62400..62756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_07g002060; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96575"
FT                   /db_xref="GOA:D6Z9P8"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96575.1"
FT                   /translation="MNVISLPYKWRVALYQVLKLASAAVGALFVIAPLFGWELPNTKLD
FT                   ALDQLVFAVVSLLGLGAGSVATEHAKISTDGPLPDPRAQAPQPDPMAVAAQTVAMTIEG
FT                   VLAQLERLAKPQGE"
     MNVISLPYKW RVALYQVLKL ASAAVGALFV IAPLFGWELP NTKLDALDQL VFAVVSLLGL        60
     GAGSVATEHA KISTDGPLPD PRAQAPQPDP MAVAAQTVAM TIEGVLAQLE RLAKPQGE         118
//

If you have problems or comments...

PBIL Back to PBIL home page