(data stored in ACNUC7421 zone)

EMBL: CP001958.PE85

CP001958.PE85        Location/Qualifiers
FT   CDS             complement(63716..64015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_2756 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96578"
FT                   /db_xref="GOA:D6Z9Q1"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96578.1"
FT                   /translation="MNDKTKTEKTPPADSPISFFWCLLASGTLILLGFTLESKFGFILL
FT                   VSLGVGVYLFRVDERWRNAGRGVIAASLAGMVFYFGWPVFYISIPAAFLSILHH"
     MNDKTKTEKT PPADSPISFF WCLLASGTLI LLGFTLESKF GFILLVSLGV GVYLFRVDER        60
     WRNAGRGVIA ASLAGMVFYF GWPVFYISIP AAFLSILHH                               99
//

If you have problems or comments...

PBIL Back to PBIL home page