(data stored in ACNUC7421 zone)

EMBL: CP001958.PE86

CP001958.PE86        Location/Qualifiers
FT   CDS             complement(64012..64293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_2455 protein of unknown function DUF6
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96579"
FT                   /db_xref="GOA:D6Z9Q2"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96579.1"
FT                   /translation="MPTIRFPAVSWNAATWSAPILTAVCEILYSLIRYFLPHEAASQRP
FT                   ALIMTCLIMACAGLLLPLIKRTPLWRGAAIGCLIVPVALAVLRENVTF"
     MPTIRFPAVS WNAATWSAPI LTAVCEILYS LIRYFLPHEA ASQRPALIMT CLIMACAGLL        60
     LPLIKRTPLW RGAAIGCLIV PVALAVLREN VTF                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page