(data stored in ACNUC7421 zone)

EMBL: CP001958.PE87

CP001958.PE87        Location/Qualifiers
FT   CDS             complement(64298..64633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_4137 amino acid/peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96580"
FT                   /db_xref="GOA:D6Z9Q3"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96580.1"
FT                   /translation="MNQRDRESDDTAPAQRLHGPESFAALVLTSAALMAVAALHMAWYV
FT                   PTVLILFLSGLAMSLTTGKQRKIGMGMLAATVSALLLRYVFWLFLYTIPGMFLALFSTK
FT                   DATHIQW"
     MNQRDRESDD TAPAQRLHGP ESFAALVLTS AALMAVAALH MAWYVPTVLI LFLSGLAMSL        60
     TTGKQRKIGM GMLAATVSAL LLRYVFWLFL YTIPGMFLAL FSTKDATHIQ W                111
//

If you have problems or comments...

PBIL Back to PBIL home page