(data stored in ACNUC7421 zone)

EMBL: CP001958.PE9

CP001958.PE9         Location/Qualifiers
FT   CDS             9013..11331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0009"
FT                   /product="glycoprotein"
FT                   /note="KEGG: rha:RHA1_ro03643 glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96502"
FT                   /db_xref="GOA:D6Z9H5"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H5"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro03643"
FT                   /protein_id="ADG96502.1"
FT                   /translation="MIARGLLRALGAWLGALCLVAALSSASAEPQTRDRAPSFLRISLD
FT                   PASLNMVTTGGEDAVDVDGEIENFSDKPVTDVEARLQRAPAVLDAAGLAASLTDPEETY
FT                   DTLGPFQLIAEHIAAHAKARFHLSLPLRGSADSLQIPNPGVYPMLVNVNGTPDSGVHAR
FT                   LDDLRFLLPVLGLPAAPGLPAQPAKIDRPARLGLVLPFADEPRWAPGSIEGDGLVRLTD
FT                   DELAGELAPDGRLGVLLAGFERLRHAAEPTANALRQGVCVAVDPDLLRTVNAMTGDYLV
FT                   QSPRDGLVAGKGSAAARDWLARLRAATAGQCVVAMPFAHADLAALAQSADPQLQKIALD
FT                   QAGDFVDNFLSVTSVRGLIVSANTRIGKPVADMLSAKGFHTVLTPRATELPDASEALGP
FT                   GLAAVHFDSTTSTLLGSLGSRNSPGLPPQDRTAQRQSAVAALLWPALQSSNPGQLPTTG
FT                   GLELLVPPSVWSPSQADFDALIFAASIALQAGIAKPISWNPVSGPRAFGAGANATAEQE
FT                   VAVAAPKTLLKPLPGSVIDAANQVRGVVDQLAAGIVDQPDDPMTAERYARSWNEQLLRT
FT                   LASGPSADGAPERMDRLGSALDAATASVCPVDPGKPYTLFTEDGSLPVVVRNGLPVSMR
FT                   VQLAVRAPSGVEVSALGPETVPAHGSRVLSLPARVKAPKLSPVEIELRTVSGLNLGNLV
FT                   TVSVQSSQYRGLVAVVTAVVGALLLALMARRLWRRITGKGGPGGRLKPDEHDRKMAGLG
FT                   FRERTLVESRHGALPPDDD"
     MIARGLLRAL GAWLGALCLV AALSSASAEP QTRDRAPSFL RISLDPASLN MVTTGGEDAV        60
     DVDGEIENFS DKPVTDVEAR LQRAPAVLDA AGLAASLTDP EETYDTLGPF QLIAEHIAAH       120
     AKARFHLSLP LRGSADSLQI PNPGVYPMLV NVNGTPDSGV HARLDDLRFL LPVLGLPAAP       180
     GLPAQPAKID RPARLGLVLP FADEPRWAPG SIEGDGLVRL TDDELAGELA PDGRLGVLLA       240
     GFERLRHAAE PTANALRQGV CVAVDPDLLR TVNAMTGDYL VQSPRDGLVA GKGSAAARDW       300
     LARLRAATAG QCVVAMPFAH ADLAALAQSA DPQLQKIALD QAGDFVDNFL SVTSVRGLIV       360
     SANTRIGKPV ADMLSAKGFH TVLTPRATEL PDASEALGPG LAAVHFDSTT STLLGSLGSR       420
     NSPGLPPQDR TAQRQSAVAA LLWPALQSSN PGQLPTTGGL ELLVPPSVWS PSQADFDALI       480
     FAASIALQAG IAKPISWNPV SGPRAFGAGA NATAEQEVAV AAPKTLLKPL PGSVIDAANQ       540
     VRGVVDQLAA GIVDQPDDPM TAERYARSWN EQLLRTLASG PSADGAPERM DRLGSALDAA       600
     TASVCPVDPG KPYTLFTEDG SLPVVVRNGL PVSMRVQLAV RAPSGVEVSA LGPETVPAHG       660
     SRVLSLPARV KAPKLSPVEI ELRTVSGLNL GNLVTVSVQS SQYRGLVAVV TAVVGALLLA       720
     LMARRLWRRI TGKGGPGGRL KPDEHDRKMA GLGFRERTLV ESRHGALPPD DD               772
//

If you have problems or comments...

PBIL Back to PBIL home page