(data stored in ACNUC7421 zone)

EMBL: CP001958.PE92

CP001958.PE92        Location/Qualifiers
FT   CDS             69928..71202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0093"
FT                   /product="Arsenical pump membrane protein"
FT                   /note="PFAM: Arsenical pump membrane protein; KEGG:
FT                   sma:SAV_7477 membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96585"
FT                   /db_xref="GOA:D6Z9Q8"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q8"
FT                   /inference="protein motif:PFAM:PF02040"
FT                   /protein_id="ADG96585.1"
FT                   /translation="MSAFGAEAVAFLLLLAVLVFAVARPKGLPEAAAAVPAAGLAVLAG
FT                   TVSWSEAVAESAGLLPVVGFLAAVLVLAELCDAEGVFRYCGSVMARGVADPVGLFGRVF
FT                   LAACAVTAVLSLDATVVLLTPVVFSTAARLGFRPKPHVYACAHLSNTGSLLLPVSNLTN
FT                   LLAFSACGLSFAGFAGVMAAPQLAAVAAEYAVLRLFFSKDLAGSGLAGAVPRGQEEPQG
FT                   QRAPVFALAVLGCVLAGFVAVQAAGASPAWAALAGAVALGVRSLAAGRTSVAKIAGSAQ
FT                   PLFLVFVLALGVVVRAVADNGLSGLLSRTLPHGEGLAALAGFALVAALVSNVINNLPAA
FT                   LALVPLAAAAGPGAVLAVLLGVNIGPNLTYAGSLATLLWRRVAQRNGHAVRLREFTRLG
FT                   ALSTPAALAAGVLGLWLSLRVGGVR"
     MSAFGAEAVA FLLLLAVLVF AVARPKGLPE AAAAVPAAGL AVLAGTVSWS EAVAESAGLL        60
     PVVGFLAAVL VLAELCDAEG VFRYCGSVMA RGVADPVGLF GRVFLAACAV TAVLSLDATV       120
     VLLTPVVFST AARLGFRPKP HVYACAHLSN TGSLLLPVSN LTNLLAFSAC GLSFAGFAGV       180
     MAAPQLAAVA AEYAVLRLFF SKDLAGSGLA GAVPRGQEEP QGQRAPVFAL AVLGCVLAGF       240
     VAVQAAGASP AWAALAGAVA LGVRSLAAGR TSVAKIAGSA QPLFLVFVLA LGVVVRAVAD       300
     NGLSGLLSRT LPHGEGLAAL AGFALVAALV SNVINNLPAA LALVPLAAAA GPGAVLAVLL       360
     GVNIGPNLTY AGSLATLLWR RVAQRNGHAV RLREFTRLGA LSTPAALAAG VLGLWLSLRV       420
     GGVR                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page