(data stored in ACNUC7421 zone)

EMBL: CP001958.PE94

CP001958.PE94        Location/Qualifiers
FT   CDS             73216..74007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0096"
FT                   /product="MspA family protein"
FT                   /note="PFAM: MspA family protein; KEGG: rer:RER_02660
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96587"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R0"
FT                   /inference="protein motif:PFAM:PF09203"
FT                   /protein_id="ADG96587.1"
FT                   /translation="MFDAIFRSNEVGAVSKVSGRTKRYRVRKNTTLGALSAALFTAVLG
FT                   ASSSYGQGLPDTVLHDVSEDGWEMVVETLDEEVNPVANLADTAFTREGFVQLTGVGKIL
FT                   GKGKYPVTAAELIIGYQIGCQIDVSQGVTLGGSLGASAGVDAYQGVGVGGIGGAGTLVP
FT                   PIGGAIIGGGGAVGGAILHEGANASIGGSVQFTLRPGGIVAIPMDRIPLKGSEARLRVR
FT                   NVNVKIDACGGPVNVRSFALLSLTTDYSHSTLATYGTEYPI"
     MFDAIFRSNE VGAVSKVSGR TKRYRVRKNT TLGALSAALF TAVLGASSSY GQGLPDTVLH        60
     DVSEDGWEMV VETLDEEVNP VANLADTAFT REGFVQLTGV GKILGKGKYP VTAAELIIGY       120
     QIGCQIDVSQ GVTLGGSLGA SAGVDAYQGV GVGGIGGAGT LVPPIGGAII GGGGAVGGAI       180
     LHEGANASIG GSVQFTLRPG GIVAIPMDRI PLKGSEARLR VRNVNVKIDA CGGPVNVRSF       240
     ALLSLTTDYS HSTLATYGTE YPI                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page