(data stored in ACNUC7421 zone)

EMBL: CP001958.PE99

CP001958.PE99        Location/Qualifiers
FT   CDS             complement(78033..78707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_1510 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96592"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96592.1"
FT                   /translation="MGKATSPRAGGASQRHGRRLTGLGLAAGLIAASVFAISRPAADAT
FT                   PGTAGGPARMNPTSWNPTDDREPFESHGPYVFDSREPYASRTGPAEYRTGVGSFGEACR
FT                   RAINTWGPIEPAYLTWRVKVESTDDYYAAEYEADKLSFYVDTAHTSIQRGLAGVPGYET
FT                   RADPIRKLDNALVLMHEMIGTGGGQAPLFPDVGIPWEHWDSMWDVLDQAHDEVLAACPA
FT                   QS"
     MGKATSPRAG GASQRHGRRL TGLGLAAGLI AASVFAISRP AADATPGTAG GPARMNPTSW        60
     NPTDDREPFE SHGPYVFDSR EPYASRTGPA EYRTGVGSFG EACRRAINTW GPIEPAYLTW       120
     RVKVESTDDY YAAEYEADKL SFYVDTAHTS IQRGLAGVPG YETRADPIRK LDNALVLMHE       180
     MIGTGGGQAP LFPDVGIPWE HWDSMWDVLD QAHDEVLAAC PAQS                        224
//

If you have problems or comments...

PBIL Back to PBIL home page