(data stored in ACNUC1104 zone)

EMBL: CP001966.PE104

CP001966.PE104       Location/Qualifiers
FT   CDS             complement(110276..110866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0104"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; KEGG: bcv:Bcav_2708 peptidase M15B and M15C
FT                   dd- carboxypeptidase VanY/endolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76758"
FT                   /db_xref="GOA:D5UPZ0"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ0"
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /protein_id="ADG76758.1"
FT                   /translation="MSNHRKARTAAAAIAALAALALLSACSPSLPGSAAPGDPTPSGRP
FT                   TAAPSGPIGAADGALTEGVPVTTDTPAITNLSPALRQALQGAARAAKAERDIDVLVTSG
FT                   WRTARYQQSLFDDAVRRYGSTAEAERVVAGTTSEHVAGDAVDIGPTDAADWMTRFGEDY
FT                   GLCRVYANEMWHFEAKSGAQCAPMVSDASRRSR"
     MSNHRKARTA AAAIAALAAL ALLSACSPSL PGSAAPGDPT PSGRPTAAPS GPIGAADGAL        60
     TEGVPVTTDT PAITNLSPAL RQALQGAARA AKAERDIDVL VTSGWRTARY QQSLFDDAVR       120
     RYGSTAEAER VVAGTTSEHV AGDAVDIGPT DAADWMTRFG EDYGLCRVYA NEMWHFEAKS       180
     GAQCAPMVSD ASRRSR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page