(data stored in ACNUC1104 zone)

EMBL: CP001966.PE105

CP001966.PE105       Location/Qualifiers
FT   CDS             complement(110968..112128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0105"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mab:MAB_4743c putative
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76759"
FT                   /db_xref="GOA:D5UPZ1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ1"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG76759.1"
FT                   /translation="MGNKRIVIAGAGIGGLSVIKELRESGVALDGVEITLIDENFEHYL
FT                   GFTLPWVMRGWRTADSIPIRPSEAALKDIRAVRATIAGVDGPGKTVLLDNGDRVGFDAL
FT                   VMALGARNATNRVPGLQEAADTGVAVHYYATADAARAHRALTDFPGGRLVFLVAAMPFR
FT                   CPVAPYEGAFLAADLLAERGVREETEIAVYTPEPQPMPSAGPHVGLELAERVRAAGIAL
FT                   HPLHQVERVDPATKIVHFADGASVPFDLLVFVPPHEAAVPLDGPGWIPVDRESMSTGQD
FT                   GIWAIGDLSAVTSPTDRPLPKAAIFAKNGAAAVARNLLQYLGLESAGAHLSGRGYCYID
FT                   TGAHESARGSGDFFAEPHPDVTLTPASAALHQDKVQEERDWRAYWE"
     MGNKRIVIAG AGIGGLSVIK ELRESGVALD GVEITLIDEN FEHYLGFTLP WVMRGWRTAD        60
     SIPIRPSEAA LKDIRAVRAT IAGVDGPGKT VLLDNGDRVG FDALVMALGA RNATNRVPGL       120
     QEAADTGVAV HYYATADAAR AHRALTDFPG GRLVFLVAAM PFRCPVAPYE GAFLAADLLA       180
     ERGVREETEI AVYTPEPQPM PSAGPHVGLE LAERVRAAGI ALHPLHQVER VDPATKIVHF       240
     ADGASVPFDL LVFVPPHEAA VPLDGPGWIP VDRESMSTGQ DGIWAIGDLS AVTSPTDRPL       300
     PKAAIFAKNG AAAVARNLLQ YLGLESAGAH LSGRGYCYID TGAHESARGS GDFFAEPHPD       360
     VTLTPASAAL HQDKVQEERD WRAYWE                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page