(data stored in ACNUC1104 zone)

EMBL: CP001966.PE107

CP001966.PE107       Location/Qualifiers
FT   CDS             113146..117753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0107"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="KEGG: rop:ROP_35350 glutamate synthase large
FT                   subunit; PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein; glutamate
FT                   synthase; glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76761"
FT                   /db_xref="GOA:D5UPZ3"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ3"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ADG76761.1"
FT                   /translation="MSRFVPPGPQGLYHPANEHDACGVAFVVDMHGRKSRDIVDKAITA
FT                   LVNLEHRGAAGAEPNTGDGAGILIQVPDRFFREVVDFDLPHQGAYATGIAFLPQAAAEA
FT                   GKAAEGVERIVAEEGMTVLGWRDQPTDDGSLGALARDAMPTMRQVFIAGTDAEGAPLSG
FT                   LDLERRCFVIRKRVERELGTDGAGAGSQGEESVYFPSLSGQTFVYKGMLTTPQLRGFFV
FT                   DLQDERVESALGLVHSRFSTNTFPSWPLAHPYRRVAHNGEINTVGGNENWMRAREALLD
FT                   PSVFGADAENKIFPICTQGGSDTARFDEVLELLHLGGRSLPHAVLMMIPEAWERHQDMD
FT                   PARRAFYEYHSSLMEPWDGPASVCFTDGTVIGAVLDRNGLRPSRIWVTKDGLVVLGSEV
FT                   GVLDIPHSDVVFKTRLQPGRMFLVDTAQGRIVSDKEIKDELAAAEPYQEWLDEGLLRLS
FT                   ELPDRPHPVMPHDRVTQRQQMFGYTTEELNLLLTPMAKTGAEAIGSMGTDTPVAVLSLR
FT                   PRLLFDYFQQLFAQVTNPPLDAIREEIVTSLGGTIGGESDLLNPSPVSCRQIHLDQPIL
FT                   NNDELIKLVKVNDDGTLPEFRSVVIPGLYAVAEGGKGLREALDTVRTQVSEAIAGGARL
FT                   IILSDRNSDRLLAPIPSLLLTAAVHHHLVRERSRTKVGLIVESGDAREVHHMAALIGCG
FT                   AAAVNPYMAFATIEDMHLRGELNGLPLEKLNANYVKAAGKGVLKVMSKMGISTLASYTG
FT                   AQLFQVIGIAQDVVDEFFSGLQSQLDGIGLDEIADDVAARHKRAMNDRPEELAHRELEV
FT                   GGEYQWRREGEYHLFNPDTVFKLQHATRTGQYKVFKEYTKLVDDQSARLASLRGLFTFV
FT                   PDREPIPLDEVEPASEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSGEGGEDP
FT                   ARFTPDENGDLRRSAIKQVASGRFGVTSHYLSNCTDIQIKMAQGAKPGEGGQLPPHKVY
FT                   PWVAEVRGSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPSARIHVKLVSELGVGTV
FT                   AAGVSKAHADVVLISGHDGGTGATPLTSVKHAGAPWEIGLAETQQTLLLNGLRDRIVVQ
FT                   VDGQLKTGRDVIVAALLGGEEFGFATAPLVVSGCIMMRVCHLDTCPVGVATQNPVLRRR
FT                   FTGKPEFVENFFLYIAEEVRELLAELGFRTLQEAVGQSHVLDTQAAQQHWSGAKAGKLD
FT                   LAPILAQVDSPFMNQDPYCSQTQEHGLEKALDQQLITQARVAIDTGAPVSIQSAISNVN
FT                   RTVGTMLGHEVTKVHGADGLPDDTIDITFRGSAGNSFGAFVPKGITLRLEGDANDFVGK
FT                   GLSGGRIVVRPAQDAPEGFIAEENIIAGNVILFGATAGEVFLRGKAGERFAVRNSGAIA
FT                   VVEGVGDHGCEYMTGGRVIVLGDTGRNFGAGMSGGIAYVYNADGQFERDLNTELVELES
FT                   LDESDIEFVRATVTKHYEATDSAIAERILANWARERQLFAKVMPRDFKRVLTAIKRAEL
FT                   DGRNIDDAVMEAARG"
     MSRFVPPGPQ GLYHPANEHD ACGVAFVVDM HGRKSRDIVD KAITALVNLE HRGAAGAEPN        60
     TGDGAGILIQ VPDRFFREVV DFDLPHQGAY ATGIAFLPQA AAEAGKAAEG VERIVAEEGM       120
     TVLGWRDQPT DDGSLGALAR DAMPTMRQVF IAGTDAEGAP LSGLDLERRC FVIRKRVERE       180
     LGTDGAGAGS QGEESVYFPS LSGQTFVYKG MLTTPQLRGF FVDLQDERVE SALGLVHSRF       240
     STNTFPSWPL AHPYRRVAHN GEINTVGGNE NWMRAREALL DPSVFGADAE NKIFPICTQG       300
     GSDTARFDEV LELLHLGGRS LPHAVLMMIP EAWERHQDMD PARRAFYEYH SSLMEPWDGP       360
     ASVCFTDGTV IGAVLDRNGL RPSRIWVTKD GLVVLGSEVG VLDIPHSDVV FKTRLQPGRM       420
     FLVDTAQGRI VSDKEIKDEL AAAEPYQEWL DEGLLRLSEL PDRPHPVMPH DRVTQRQQMF       480
     GYTTEELNLL LTPMAKTGAE AIGSMGTDTP VAVLSLRPRL LFDYFQQLFA QVTNPPLDAI       540
     REEIVTSLGG TIGGESDLLN PSPVSCRQIH LDQPILNNDE LIKLVKVNDD GTLPEFRSVV       600
     IPGLYAVAEG GKGLREALDT VRTQVSEAIA GGARLIILSD RNSDRLLAPI PSLLLTAAVH       660
     HHLVRERSRT KVGLIVESGD AREVHHMAAL IGCGAAAVNP YMAFATIEDM HLRGELNGLP       720
     LEKLNANYVK AAGKGVLKVM SKMGISTLAS YTGAQLFQVI GIAQDVVDEF FSGLQSQLDG       780
     IGLDEIADDV AARHKRAMND RPEELAHREL EVGGEYQWRR EGEYHLFNPD TVFKLQHATR       840
     TGQYKVFKEY TKLVDDQSAR LASLRGLFTF VPDREPIPLD EVEPASEIVK RFSTGAMSYG       900
     SISAEAHETL AIAMNRLGGR SNSGEGGEDP ARFTPDENGD LRRSAIKQVA SGRFGVTSHY       960
     LSNCTDIQIK MAQGAKPGEG GQLPPHKVYP WVAEVRGSTP GVGLISPPPH HDIYSIEDLA      1020
     QLIHDLKNAN PSARIHVKLV SELGVGTVAA GVSKAHADVV LISGHDGGTG ATPLTSVKHA      1080
     GAPWEIGLAE TQQTLLLNGL RDRIVVQVDG QLKTGRDVIV AALLGGEEFG FATAPLVVSG      1140
     CIMMRVCHLD TCPVGVATQN PVLRRRFTGK PEFVENFFLY IAEEVRELLA ELGFRTLQEA      1200
     VGQSHVLDTQ AAQQHWSGAK AGKLDLAPIL AQVDSPFMNQ DPYCSQTQEH GLEKALDQQL      1260
     ITQARVAIDT GAPVSIQSAI SNVNRTVGTM LGHEVTKVHG ADGLPDDTID ITFRGSAGNS      1320
     FGAFVPKGIT LRLEGDANDF VGKGLSGGRI VVRPAQDAPE GFIAEENIIA GNVILFGATA      1380
     GEVFLRGKAG ERFAVRNSGA IAVVEGVGDH GCEYMTGGRV IVLGDTGRNF GAGMSGGIAY      1440
     VYNADGQFER DLNTELVELE SLDESDIEFV RATVTKHYEA TDSAIAERIL ANWARERQLF      1500
     AKVMPRDFKR VLTAIKRAEL DGRNIDDAVM EAARG                                 1535
//

If you have problems or comments...

PBIL Back to PBIL home page