(data stored in ACNUC1104 zone)

EMBL: CP001966.PE108

CP001966.PE108       Location/Qualifiers
FT   CDS             117746..119212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0108"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="KEGG: nfa:nfa970 glutamate synthase subunit beta;
FT                   TIGRFAM: glutamate synthase, NADH/NADPH, small subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76762"
FT                   /db_xref="GOA:D5UPZ4"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ4"
FT                   /inference="protein motif:TFAM:TIGR01317"
FT                   /protein_id="ADG76762.1"
FT                   /translation="MADPQGFLKNNSRELPVRRPVPLRLLDWNEVYKPFDGGTLRKQAS
FT                   RCMDCGIPFCHNGCPLGNLIPEWNDLVYKDRWRDGIDRLHATNNFPEFTGRLCPAPCEA
FT                   SCVLGINQDPVTIKQVEVELIDHAFDEGWVSPEHPTKLTGKKVAVVGSGPAGLAAAQQL
FT                   TRGGHTVTVYERADRIGGLLRYGIPEFKMEKRHIDRRLAQMNAEGTIFKTGVNVGVDVT
FT                   VEQLREDYDAVVLANGATLWRDLPIPGRDLDGIHQAMEFLPWANRAAVGDDVVDADGLP
FT                   PLHAKGKKVVIIGGGDTGADCLGTSLRQGAETVHQFEIMPIPPRERAESTPWPTYPLMY
FT                   RISSAHEEGGERVFSVSTEEFLGHDGTVTGLKAYEVKMEGGRFEKVEGTDFTLEADLVL
FT                   LAMGFVGPERGDLLDKLGVEYSERGNVARGDDFQSTVPGVFVAGDAGRGQSLIVWAIAE
FT                   GRSAAAAVDRFLMGESALPAPIVPTAAPQR"
     MADPQGFLKN NSRELPVRRP VPLRLLDWNE VYKPFDGGTL RKQASRCMDC GIPFCHNGCP        60
     LGNLIPEWND LVYKDRWRDG IDRLHATNNF PEFTGRLCPA PCEASCVLGI NQDPVTIKQV       120
     EVELIDHAFD EGWVSPEHPT KLTGKKVAVV GSGPAGLAAA QQLTRGGHTV TVYERADRIG       180
     GLLRYGIPEF KMEKRHIDRR LAQMNAEGTI FKTGVNVGVD VTVEQLREDY DAVVLANGAT       240
     LWRDLPIPGR DLDGIHQAME FLPWANRAAV GDDVVDADGL PPLHAKGKKV VIIGGGDTGA       300
     DCLGTSLRQG AETVHQFEIM PIPPRERAES TPWPTYPLMY RISSAHEEGG ERVFSVSTEE       360
     FLGHDGTVTG LKAYEVKMEG GRFEKVEGTD FTLEADLVLL AMGFVGPERG DLLDKLGVEY       420
     SERGNVARGD DFQSTVPGVF VAGDAGRGQS LIVWAIAEGR SAAAAVDRFL MGESALPAPI       480
     VPTAAPQR                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page