(data stored in ACNUC1104 zone)

EMBL: CP001966.PE110

CP001966.PE110       Location/Qualifiers
FT   CDS             complement(120144..121070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0110"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rha:RHA1_ro03731 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76764"
FT                   /db_xref="GOA:D5UPZ6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG76764.1"
FT                   /translation="MTTTPATTAQCTNRMVVLPAHWTTKSTTLGSVLLELANVRTHVVI
FT                   DQPTGPVTGPPVVLSSGLAGNWFDWDSCIELLRSERTVIRFDRPGYGLSDPWPEDTVPT
FT                   LDGEVRRYRDLLDALQIQRGVICGHSMASFYVEAFAREHPERTAAAVILDGSVEDSPRW
FT                   VLPTNLRADLLLRSADVAAASGLSRIGPAVHKLLVDSEPPAEHAQILSSEQYLRAAMLE
FT                   NGQYPVLAHELVDLRTKQPLQPGLPVTVAAAYTGRPTPWAASWLRQQRGLADRLDARFA
FT                   VIAPSGHHVMVEQPAQVAALILDAGGG"
     MTTTPATTAQ CTNRMVVLPA HWTTKSTTLG SVLLELANVR THVVIDQPTG PVTGPPVVLS        60
     SGLAGNWFDW DSCIELLRSE RTVIRFDRPG YGLSDPWPED TVPTLDGEVR RYRDLLDALQ       120
     IQRGVICGHS MASFYVEAFA REHPERTAAA VILDGSVEDS PRWVLPTNLR ADLLLRSADV       180
     AAASGLSRIG PAVHKLLVDS EPPAEHAQIL SSEQYLRAAM LENGQYPVLA HELVDLRTKQ       240
     PLQPGLPVTV AAAYTGRPTP WAASWLRQQR GLADRLDARF AVIAPSGHHV MVEQPAQVAA       300
     LILDAGGG                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page