(data stored in ACNUC1104 zone)

EMBL: CP001966.PE112

CP001966.PE112       Location/Qualifiers
FT   CDS             121868..122110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0112"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   mgi:Mflv_3643 RNA-binding S4 domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76766"
FT                   /db_xref="GOA:D5UPZ8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ8"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADG76766.1"
FT                   /translation="MLRHDGPVSEAIDVEISDEVIRLGQFLKLAGLIDSGAEAKGVIAD
FT                   GEVSVNGEVDTRRGRQLAVGDVVEVFGRSARVARG"
     MLRHDGPVSE AIDVEISDEV IRLGQFLKLA GLIDSGAEAK GVIADGEVSV NGEVDTRRGR        60
     QLAVGDVVEV FGRSARVARG                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page