(data stored in ACNUC1104 zone)

EMBL: CP001966.PE117

CP001966.PE117       Location/Qualifiers
FT   CDS             complement(125702..126616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0117"
FT                   /product="GDSL family lipase"
FT                   /note="KEGG: nca:Noca_4490 GDSL family lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76771"
FT                   /db_xref="GOA:D5UQ03"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ03"
FT                   /inference="similar to AA sequence:KEGG:Noca_4490"
FT                   /protein_id="ADG76771.1"
FT                   /translation="MRFRTLLLSLVAAVAAAPALPANAAPPAPTYVALGDSYSSLPADA
FT                   TVGDSQQERSCGRSTRNYPKLVADALGVPRVQLRDNTCGGADTDDAFSSQRAGDAKTGY
FT                   YDAAPQLDGIVPQTRLVTISLGGNDGDLYSSILKACATVARAAAPRCTADPASRPATLS
FT                   DAAVADRLGRITAANERIIRAVRERSPQARILVIGYPSVFGPDRTCAAIAPYRPESIPW
FT                   MRSILTERLNRAVQRAAVAERAEYIDMEPASKGRDVCSPRPWINGVTDVPRAAGMHPFP
FT                   EEGEAVAAAITRAVRASGPAVGR"
     MRFRTLLLSL VAAVAAAPAL PANAAPPAPT YVALGDSYSS LPADATVGDS QQERSCGRST        60
     RNYPKLVADA LGVPRVQLRD NTCGGADTDD AFSSQRAGDA KTGYYDAAPQ LDGIVPQTRL       120
     VTISLGGNDG DLYSSILKAC ATVARAAAPR CTADPASRPA TLSDAAVADR LGRITAANER       180
     IIRAVRERSP QARILVIGYP SVFGPDRTCA AIAPYRPESI PWMRSILTER LNRAVQRAAV       240
     AERAEYIDME PASKGRDVCS PRPWINGVTD VPRAAGMHPF PEEGEAVAAA ITRAVRASGP       300
     AVGR                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page