(data stored in ACNUC1104 zone)

EMBL: CP001966.PE118

CP001966.PE118       Location/Qualifiers
FT   CDS             complement(126666..127361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76772"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ04"
FT                   /inference="similar to AA sequence:KEGG:MAV_0179"
FT                   /protein_id="ADG76772.1"
FT                   /translation="MGLFGKKQKSSRAERRAQAKALKSKARLEAKLAAKNTAKSAKRSA
FT                   KNAVKSERGAQKSDVARAKVIARMQGKSDKLNLKIAETNARAAVDGKLLSEARLKRYVS
FT                   TARLLAPVVVPLAYRAAQAGRNKLDSARATRLGVPVDEVAQFAGFGGGLAARVAASRRS
FT                   LDQLATAHPDAETKAFVAAVAQRLDDLSAAITASESMPPARRRPAHQAIARELDGIDAD
FT                   LLNRLGVSS"
     MGLFGKKQKS SRAERRAQAK ALKSKARLEA KLAAKNTAKS AKRSAKNAVK SERGAQKSDV        60
     ARAKVIARMQ GKSDKLNLKI AETNARAAVD GKLLSEARLK RYVSTARLLA PVVVPLAYRA       120
     AQAGRNKLDS ARATRLGVPV DEVAQFAGFG GGLAARVAAS RRSLDQLATA HPDAETKAFV       180
     AAVAQRLDDL SAAITASESM PPARRRPAHQ AIARELDGID ADLLNRLGVS S                231
//

If you have problems or comments...

PBIL Back to PBIL home page