(data stored in ACNUC1104 zone)

EMBL: CP001966.PE119

CP001966.PE119       Location/Qualifiers
FT   CDS             127572..129011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0119"
FT                   /product="RecB family nuclease, putative"
FT                   /note="TIGRFAM: RecB family nuclease, putative; KEGG:
FT                   nfa:nfa1140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76773"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ05"
FT                   /inference="protein motif:TFAM:TIGR03491"
FT                   /protein_id="ADG76773.1"
FT                   /translation="MALRMEAAAVFRASIRDRLAALGPLTVIEPGEGAVTRTLAALGAG
FT                   AERIWGGVLPTANGRRGHSELLLRVRDGYLPVIVVNHKVSDPGSGALTSPLDRWAPVPD
FT                   ETVRARQHRGDQMRLAHLTRMLQDAGYASASLSGGSLGIGGDRIVVHDVAPLLPAYDER
FT                   FADRRDVLSGAVVTAPVRVAECRRCPWWPECERTLAATRDVSLVADGRSAPGLREAGIV
FT                   TVDQLAEYTGPQPDEVSVPIADLRAMARAWQRGQVLVRRRPEVKVRRADVEVDVDMESY
FT                   QEYGAYLWGTWLRRDGVDLGYRPFVTWEAVPTRDEGRSFAEFWAYLMDRRAEAHAAGKT
FT                   FAAYCYSQQAENKWLLSSADRFAGDPGVPSRAAVAEFIASPEWVDMFDAVGEAFLSLEG
FT                   RGLKKVAPVAGFHWRDAEAGGEASMLWYRVGVGMDPGYDAAERETQRQRILEYNEDDVR
FT                   ATAALRAFMSSDAVNDLPVVH"
     MALRMEAAAV FRASIRDRLA ALGPLTVIEP GEGAVTRTLA ALGAGAERIW GGVLPTANGR        60
     RGHSELLLRV RDGYLPVIVV NHKVSDPGSG ALTSPLDRWA PVPDETVRAR QHRGDQMRLA       120
     HLTRMLQDAG YASASLSGGS LGIGGDRIVV HDVAPLLPAY DERFADRRDV LSGAVVTAPV       180
     RVAECRRCPW WPECERTLAA TRDVSLVADG RSAPGLREAG IVTVDQLAEY TGPQPDEVSV       240
     PIADLRAMAR AWQRGQVLVR RRPEVKVRRA DVEVDVDMES YQEYGAYLWG TWLRRDGVDL       300
     GYRPFVTWEA VPTRDEGRSF AEFWAYLMDR RAEAHAAGKT FAAYCYSQQA ENKWLLSSAD       360
     RFAGDPGVPS RAAVAEFIAS PEWVDMFDAV GEAFLSLEGR GLKKVAPVAG FHWRDAEAGG       420
     EASMLWYRVG VGMDPGYDAA ERETQRQRIL EYNEDDVRAT AALRAFMSSD AVNDLPVVH        479
//

If you have problems or comments...

PBIL Back to PBIL home page