(data stored in ACNUC1104 zone)

EMBL: CP001966.PE12

CP001966.PE12        Location/Qualifiers
FT   CDS             complement(15745..16197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76666"
FT                   /db_xref="GOA:D5UPB4"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76666.1"
FT                   /translation="MGKHSSTRESPDVSAWLLVANPLCLLFGLYAVWTGAVIITGPATC
FT                   DMKTMTAADVCATGRKLLDEQLLVDAAPTPPTDGKYRTYAQQQSFNRVAGPGRVIVGLV
FT                   VVAGSLWLGLAQARGLQTRRELRRRQVRGAAAGQDNKGGLADTRPP"
     MGKHSSTRES PDVSAWLLVA NPLCLLFGLY AVWTGAVIIT GPATCDMKTM TAADVCATGR        60
     KLLDEQLLVD AAPTPPTDGK YRTYAQQQSF NRVAGPGRVI VGLVVVAGSL WLGLAQARGL       120
     QTRRELRRRQ VRGAAAGQDN KGGLADTRPP                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page