(data stored in ACNUC1104 zone)

EMBL: CP001966.PE126

CP001966.PE126       Location/Qualifiers
FT   CDS             complement(134490..135092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0126"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="KEGG: rer:RER_48670 superoxide dismutase; PFAM:
FT                   Manganese/iron superoxide dismutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76780"
FT                   /db_xref="GOA:D5UQ12"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ12"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ADG76780.1"
FT                   /translation="MAVYTLPDLDYDYSALEPHISGEIMELHHSKHHATYVAGANAALE
FT                   QLAEAREDGSIATKAPLLSKNLAFHLGGHTNHSIFWKNLSPNGGDKPVGDLAAAIDEYF
FT                   GGFDKFQAHFTAVANSLQGSGWSVLAYDHIGQRLVIQQLTDQQGNISINLTPLLMLDMW
FT                   EHAFYLQYKNVKADYVKAWWNVVNWEDVAARYAAAKG"
     MAVYTLPDLD YDYSALEPHI SGEIMELHHS KHHATYVAGA NAALEQLAEA REDGSIATKA        60
     PLLSKNLAFH LGGHTNHSIF WKNLSPNGGD KPVGDLAAAI DEYFGGFDKF QAHFTAVANS       120
     LQGSGWSVLA YDHIGQRLVI QQLTDQQGNI SINLTPLLML DMWEHAFYLQ YKNVKADYVK       180
     AWWNVVNWED VAARYAAAKG                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page