(data stored in ACNUC1104 zone)

EMBL: CP001966.PE127

CP001966.PE127       Location/Qualifiers
FT   CDS             complement(135231..135434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76781"
FT                   /db_xref="GOA:D5UQ13"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76781.1"
FT                   /translation="MVVAITLVTGFTATRWGRRAMTVKHTNAGATSSPTHATTVHFSRS
FT                   LTRTSLTVAVLAAALVLILLLR"
     MVVAITLVTG FTATRWGRRA MTVKHTNAGA TSSPTHATTV HFSRSLTRTS LTVAVLAAAL        60
     VLILLLR                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page