(data stored in ACNUC1104 zone)

EMBL: CP001966.PE128

CP001966.PE128       Location/Qualifiers
FT   CDS             135665..136063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76782"
FT                   /db_xref="GOA:D5UQ14"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76782.1"
FT                   /translation="MTEFSVGVREASPQAGRATRLRTLVGGRQTRTDVVVAITLLAISI
FT                   GATITNLYLTVQALPSFRECAAMACTYGSHFDVFAITFVVSLLVGTTFGAHAVLNLLNR
FT                   RNAWGYALLDAIISVGSLLAGLLWVSAV"
     MTEFSVGVRE ASPQAGRATR LRTLVGGRQT RTDVVVAITL LAISIGATIT NLYLTVQALP        60
     SFRECAAMAC TYGSHFDVFA ITFVVSLLVG TTFGAHAVLN LLNRRNAWGY ALLDAIISVG       120
     SLLAGLLWVS AV                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page