(data stored in ACNUC1104 zone)

EMBL: CP001966.PE13

CP001966.PE13        Location/Qualifiers
FT   CDS             16298..16852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbt:JTY_1130 putative membrane glycine and
FT                   proline rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76667"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76667.1"
FT                   /translation="MIALKTRTALAAVVAGASVATMTAAPAVADPARVVAGPLSIDRGT
FT                   LAGWEITAPDAEGTVVAGVKLAGKNWGSQIEFGPSLVKGASTDAVARTIVTRSLESDGY
FT                   KGLKGRVVGVQVTPTSVSGVPATRATAEVQFDGAPVRADRLRVVVVDTTPQTYFLSAVP
FT                   VEAPDRLGQADAAERSLVAAR"
     MIALKTRTAL AAVVAGASVA TMTAAPAVAD PARVVAGPLS IDRGTLAGWE ITAPDAEGTV        60
     VAGVKLAGKN WGSQIEFGPS LVKGASTDAV ARTIVTRSLE SDGYKGLKGR VVGVQVTPTS       120
     VSGVPATRAT AEVQFDGAPV RADRLRVVVV DTTPQTYFLS AVPVEAPDRL GQADAAERSL       180
     VAAR                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page