(data stored in ACNUC1104 zone)

EMBL: CP001966.PE131

CP001966.PE131       Location/Qualifiers
FT   CDS             137586..137936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0131"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: nfa:nfa1230 hypothetical protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76785"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ17"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADG76785.1"
FT                   /translation="MMDARGFPTDDGLISIDALPEVATITLLDVREPDEWELGHAPGAL
FT                   HIPLSDLPLRFEEIDLDSDVYVICRGGGRSESAVRYLETVGVEAAVVDGGMIAWAAAAK
FT                   PVVRSDGGPGVV"
     MMDARGFPTD DGLISIDALP EVATITLLDV REPDEWELGH APGALHIPLS DLPLRFEEID        60
     LDSDVYVICR GGGRSESAVR YLETVGVEAA VVDGGMIAWA AAAKPVVRSD GGPGVV           116
//

If you have problems or comments...

PBIL Back to PBIL home page