(data stored in ACNUC1104 zone)

EMBL: CP001966.PE134

CP001966.PE134       Location/Qualifiers
FT   CDS             139530..140426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_01720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76788"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ20"
FT                   /inference="similar to AA sequence:KEGG:RER_01720"
FT                   /protein_id="ADG76788.1"
FT                   /translation="MGRRERNATPREGSNRAEKVAAQRARSAESAAAARRPFEGLAAEC
FT                   DLIALRQFVPSATAPLAVSGSSREIRLATVLPGASFALVRDEAEGTVGYAALQTSVRPE
FT                   DPAAALAGAARFAADADTGEVLSEPAGGVITDVLDDGAALDITVHTDFNWWLAGEPDAQ
FT                   TRQLVDHANSLITPAARLDLGADGVGAPWWADTGSKAHLRWVHPAPEDELMAALARVHA
FT                   AGGLTLGEGSKFAGSFRADGLLIPVFDLDRESHPDEWVPGTVELGKRLAEALADDSELT
FT                   AAQRRSRDGLRDRQVSI"
     MGRRERNATP REGSNRAEKV AAQRARSAES AAAARRPFEG LAAECDLIAL RQFVPSATAP        60
     LAVSGSSREI RLATVLPGAS FALVRDEAEG TVGYAALQTS VRPEDPAAAL AGAARFAADA       120
     DTGEVLSEPA GGVITDVLDD GAALDITVHT DFNWWLAGEP DAQTRQLVDH ANSLITPAAR       180
     LDLGADGVGA PWWADTGSKA HLRWVHPAPE DELMAALARV HAAGGLTLGE GSKFAGSFRA       240
     DGLLIPVFDL DRESHPDEWV PGTVELGKRL AEALADDSEL TAAQRRSRDG LRDRQVSI         298
//

If you have problems or comments...

PBIL Back to PBIL home page