(data stored in ACNUC1104 zone)

EMBL: CP001966.PE135

CP001966.PE135       Location/Qualifiers
FT   CDS             complement(140423..141076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0135"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nfa:nfa33150
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76789"
FT                   /db_xref="GOA:D5UQ21"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ21"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76789.1"
FT                   /translation="MTDERGRIGRPPKVNREQVVAAAADILTNDGPLKFSMRALASRLD
FT                   ISAMGIYHYFDSKNDLLGAVLEHQAWNTPVPELSDDPRERLVELPLAVITHLSRHPWVI
FT                   DVLSADEIIDAFSAWAFNEFLLTTDRLGIGEEDSLQLLFGIWRIVVGEVVVRNNIAMRN
FT                   ERPTQPWYEREVPAHVTERERLMQALGNVDDGINAYDVEVTLRAYLVGQLGQPA"
     MTDERGRIGR PPKVNREQVV AAAADILTND GPLKFSMRAL ASRLDISAMG IYHYFDSKND        60
     LLGAVLEHQA WNTPVPELSD DPRERLVELP LAVITHLSRH PWVIDVLSAD EIIDAFSAWA       120
     FNEFLLTTDR LGIGEEDSLQ LLFGIWRIVV GEVVVRNNIA MRNERPTQPW YEREVPAHVT       180
     ERERLMQALG NVDDGINAYD VEVTLRAYLV GQLGQPA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page