(data stored in ACNUC1104 zone)

EMBL: CP001966.PE139

CP001966.PE139       Location/Qualifiers
FT   CDS             complement(144880..145698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_1432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76793"
FT                   /db_xref="GOA:D5UQ25"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76793.1"
FT                   /translation="MSATPDDPTPQQHEGEPKPDLASRTKAHVGDVTTRARTHADDAAT
FT                   RAKTKAGDAASRAGEAAKRWLRRAIVAAIVVAVLVAAYFALAAYLPRKWADLLVGWVGT
FT                   DGGTLKGTVFGLGIGFLCAGLPLLLLWFAAKRAANHPKIATVLGLIAVIATVPNLMTLA
FT                   VAIGTGSGASYARTKIDQNAAGFRWATLIGVVIGVIAAIALAIFLEVQRRKRAKKKQQK
FT                   ALEKEAKAAQKQAEKDAKAAEKALKSGHAASSLDDEPSAPSGGGTGPSGT"
     MSATPDDPTP QQHEGEPKPD LASRTKAHVG DVTTRARTHA DDAATRAKTK AGDAASRAGE        60
     AAKRWLRRAI VAAIVVAVLV AAYFALAAYL PRKWADLLVG WVGTDGGTLK GTVFGLGIGF       120
     LCAGLPLLLL WFAAKRAANH PKIATVLGLI AVIATVPNLM TLAVAIGTGS GASYARTKID       180
     QNAAGFRWAT LIGVVIGVIA AIALAIFLEV QRRKRAKKKQ QKALEKEAKA AQKQAEKDAK       240
     AAEKALKSGH AASSLDDEPS APSGGGTGPS GT                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page