(data stored in ACNUC1104 zone)

EMBL: CP001966.PE140

CP001966.PE140       Location/Qualifiers
FT   CDS             145812..146390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0140"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mmi:MMAR_1611
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76794"
FT                   /db_xref="GOA:D5UQ26"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ26"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76794.1"
FT                   /translation="MSDGPRRRDPERRRREIVDAAAALVLESGADALTHRKVAARAGVP
FT                   LGSTTQYFATLDDLREAALRNLMDEAEQWLADLEAEFVRDGASSAAYTGALHRYLSDPQ
FT                   LVRGDFAMTCAAASSPDMEELARHWTARLVEALARYIPVENARAVATFSDGATMDAVIA
FT                   ERPLDHALLASAIAALWSAPLGATKGTAT"
     MSDGPRRRDP ERRRREIVDA AAALVLESGA DALTHRKVAA RAGVPLGSTT QYFATLDDLR        60
     EAALRNLMDE AEQWLADLEA EFVRDGASSA AYTGALHRYL SDPQLVRGDF AMTCAAASSP       120
     DMEELARHWT ARLVEALARY IPVENARAVA TFSDGATMDA VIAERPLDHA LLASAIAALW       180
     SAPLGATKGT AT                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page