(data stored in ACNUC1104 zone)

EMBL: CP001966.PE142

CP001966.PE142       Location/Qualifiers
FT   CDS             complement(147928..148665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_01850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76796"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ28"
FT                   /inference="similar to AA sequence:KEGG:RER_01850"
FT                   /protein_id="ADG76796.1"
FT                   /translation="MSAPTIAEPTPAERVRTVAVVPHAAVLVADGHEPITIALHHVLGD
FT                   RLVIAVADDTPWLDGARAMVEINDISPLALRERTRSLVWLSGNLSEVADGAALAARVAI
FT                   ENPLESLLDVGNGSRLLTMPVETAVLADTAGASSVSGDELAAADPDPFAGYEAAWLAHV
FT                   ENDHPEMVGQLARRIPGKLRNHRIRLLGIDRFGIRLRAEHHELSDVDVRLNFAQPATDM
FT                   AALQRGIRILLGCPFLNGLRAAG"
     MSAPTIAEPT PAERVRTVAV VPHAAVLVAD GHEPITIALH HVLGDRLVIA VADDTPWLDG        60
     ARAMVEINDI SPLALRERTR SLVWLSGNLS EVADGAALAA RVAIENPLES LLDVGNGSRL       120
     LTMPVETAVL ADTAGASSVS GDELAAADPD PFAGYEAAWL AHVENDHPEM VGQLARRIPG       180
     KLRNHRIRLL GIDRFGIRLR AEHHELSDVD VRLNFAQPAT DMAALQRGIR ILLGCPFLNG       240
     LRAAG                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page