(data stored in ACNUC1104 zone)

EMBL: CP001966.PE143

CP001966.PE143       Location/Qualifiers
FT   CDS             148750..149148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_01860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76797"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ29"
FT                   /inference="similar to AA sequence:KEGG:RER_01860"
FT                   /protein_id="ADG76797.1"
FT                   /translation="MMAIELELLAPPREPMSLVDGLAIAGPSELTTQAYHPDDPRELVE
FT                   FLVRGVHESGPGFALEVTGPDAAVAVLCATVAALTGDDIEGALADPDEQRLAGLNPMAQ
FT                   DALRERLRHLIAPDPQAITDRLHALGLR"
     MMAIELELLA PPREPMSLVD GLAIAGPSEL TTQAYHPDDP RELVEFLVRG VHESGPGFAL        60
     EVTGPDAAVA VLCATVAALT GDDIEGALAD PDEQRLAGLN PMAQDALRER LRHLIAPDPQ       120
     AITDRLHALG LR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page