(data stored in ACNUC1104 zone)

EMBL: CP001966.PE148

CP001966.PE148       Location/Qualifiers
FT   CDS             complement(152156..153244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_39180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76802"
FT                   /db_xref="GOA:D5UQ34"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ34"
FT                   /inference="similar to AA sequence:KEGG:ROP_39180"
FT                   /protein_id="ADG76802.1"
FT                   /translation="MADDTDTQPEPVQPPDGPDRLASDDAAAAKPDPLAGPVDADVTDL
FT                   RAGRVSAANLRAVLIAVIVGALALGGTLYAAGYFDPVSEDHGPRLAANGSTLARSKPGS
FT                   CITWDTAGALAAVDCSASHKFEVAGEPANTLPPDAKYPSEQQIAALREQVCTPVVAEYL
FT                   GQRLDPKGRYQMGLLTAGEKAWEGGDRTMRCGVQLVDGSGAVVDSTGKVANQDKATSWP
FT                   VGTCIGINDRGQATVPVDCSAPHAFEVTATVDLRQKFPDASWPTLAQQEDYLGGTCPAR
FT                   TTAWFGAQDGLRKSGLQLQWNTLSQEAWTAGARTSVCFVAASDGKKFIPVTGSAKSPNL
FT                   LIDGKKPVMPTFPGAAPPKPGR"
     MADDTDTQPE PVQPPDGPDR LASDDAAAAK PDPLAGPVDA DVTDLRAGRV SAANLRAVLI        60
     AVIVGALALG GTLYAAGYFD PVSEDHGPRL AANGSTLARS KPGSCITWDT AGALAAVDCS       120
     ASHKFEVAGE PANTLPPDAK YPSEQQIAAL REQVCTPVVA EYLGQRLDPK GRYQMGLLTA       180
     GEKAWEGGDR TMRCGVQLVD GSGAVVDSTG KVANQDKATS WPVGTCIGIN DRGQATVPVD       240
     CSAPHAFEVT ATVDLRQKFP DASWPTLAQQ EDYLGGTCPA RTTAWFGAQD GLRKSGLQLQ       300
     WNTLSQEAWT AGARTSVCFV AASDGKKFIP VTGSAKSPNL LIDGKKPVMP TFPGAAPPKP       360
     GR                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page