(data stored in ACNUC1104 zone)

EMBL: CP001966.PE149

CP001966.PE149       Location/Qualifiers
FT   CDS             153319..154572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0149"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: mab:MAB_0153
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76803"
FT                   /db_xref="GOA:D5UQ35"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ35"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADG76803.1"
FT                   /translation="MIDVKLLRENPDLVRASQRARGEDAALVDALLEADAHRRAAVLAA
FT                   DNLRAEHKTSSKSIGKAAPEERPALVAAAGELAAKVKEAEAEQARADEVFDETARKIGN
FT                   VIIEGVPAGGEDDFEVLEHVGTIPEITDPKDHLELAEGLGLLDMERGAKVSGSRFYFMT
FT                   GHGALFQMALLQLAVQKAVAHGFTLMIPPVLVKPEIMGGTGFLGAHADEIYRLEADDLY
FT                   LVGTSEVPLAGYHMGEIIDLNDGPIRYAAQSSCFRREAGSYGKDTRGIIRVHQFDKIEM
FT                   FVYCKPEDAEAEHQRLLDFEKEMLAAVEVPYRVIDVAAGDLGSSAARKFDCEAWVPSQE
FT                   RYRELTSTSNCTTFQARRLGVRYRDEDGRPQIAATLNGTLATTRWLVAIWENHQQPDGS
FT                   VRVPAALQPFLGTDVLRP"
     MIDVKLLREN PDLVRASQRA RGEDAALVDA LLEADAHRRA AVLAADNLRA EHKTSSKSIG        60
     KAAPEERPAL VAAAGELAAK VKEAEAEQAR ADEVFDETAR KIGNVIIEGV PAGGEDDFEV       120
     LEHVGTIPEI TDPKDHLELA EGLGLLDMER GAKVSGSRFY FMTGHGALFQ MALLQLAVQK       180
     AVAHGFTLMI PPVLVKPEIM GGTGFLGAHA DEIYRLEADD LYLVGTSEVP LAGYHMGEII       240
     DLNDGPIRYA AQSSCFRREA GSYGKDTRGI IRVHQFDKIE MFVYCKPEDA EAEHQRLLDF       300
     EKEMLAAVEV PYRVIDVAAG DLGSSAARKF DCEAWVPSQE RYRELTSTSN CTTFQARRLG       360
     VRYRDEDGRP QIAATLNGTL ATTRWLVAIW ENHQQPDGSV RVPAALQPFL GTDVLRP          417
//

If you have problems or comments...

PBIL Back to PBIL home page