(data stored in ACNUC1104 zone)

EMBL: CP001966.PE15

CP001966.PE15        Location/Qualifiers
FT   CDS             17428..18780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0015"
FT                   /product="protein of unknown function DUF21"
FT                   /note="KEGG: mgi:Mflv_2683 CBS domain-containing protein;
FT                   PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; SMART:
FT                   CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76669"
FT                   /db_xref="GOA:D5UPB7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB7"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADG76669.1"
FT                   /translation="MLAVLSILAGIVVVLLITAFTGYFVAQEFAYMAVDRSRLKARAET
FT                   GDPAANRALSVTKRTSFMLSGAQLGITVTGLLVGYVAEPLIGQGLGTLLGGVGVPSAVG
FT                   IAIGAIAAVGLSTVAQMVFGELFPKNLAISRPEPVALQLSLSTTIYLKVFGWLIRFFDA
FT                   ASNVLLRAVRIEPVHDVEHSATPRDLEHIVAASRDAGELPAELSTLLDRILDFPTHTAE
FT                   HAMIPRSRVDVVPAGEPAGAVLDRMADGHTRYPVVGATSDDLIGVITLHDLLTDTSGTA
FT                   ATRCRPAVVVPASLPLPAVVAQLADARQEMALVIDEYGGFDGVVTVEDIAEELVGEIDD
FT                   EHDPGAADPAVPEGEGWLVRGDLHIDELERLLDLDLEPGDYETIGGAVITRLAALPRPG
FT                   DTVDLPVVPEPPNLLDDAPPQRFLRAEVRTVERRVPDRVHLTVRTEEAGDG"
     MLAVLSILAG IVVVLLITAF TGYFVAQEFA YMAVDRSRLK ARAETGDPAA NRALSVTKRT        60
     SFMLSGAQLG ITVTGLLVGY VAEPLIGQGL GTLLGGVGVP SAVGIAIGAI AAVGLSTVAQ       120
     MVFGELFPKN LAISRPEPVA LQLSLSTTIY LKVFGWLIRF FDAASNVLLR AVRIEPVHDV       180
     EHSATPRDLE HIVAASRDAG ELPAELSTLL DRILDFPTHT AEHAMIPRSR VDVVPAGEPA       240
     GAVLDRMADG HTRYPVVGAT SDDLIGVITL HDLLTDTSGT AATRCRPAVV VPASLPLPAV       300
     VAQLADARQE MALVIDEYGG FDGVVTVEDI AEELVGEIDD EHDPGAADPA VPEGEGWLVR       360
     GDLHIDELER LLDLDLEPGD YETIGGAVIT RLAALPRPGD TVDLPVVPEP PNLLDDAPPQ       420
     RFLRAEVRTV ERRVPDRVHL TVRTEEAGDG                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page