(data stored in ACNUC1104 zone)

EMBL: CP001966.PE151

CP001966.PE151       Location/Qualifiers
FT   CDS             complement(155001..155735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_F0186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76805"
FT                   /db_xref="GOA:D5UQ37"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76805.1"
FT                   /translation="MSEPEFDRERRAAARSVRESHLMVRLFIALGVLTIAAGCYFTVVD
FT                   TMFLASASTAEGRVVDYEESASPKENGRTEYSYQRIVGYTVDGVDYRKRESGASSSEPA
FT                   IGDAVTVYYDPDDPQHAMIDAFMRKWLGPLAIIFGVLWTALFAAIQRWTRRKQGERERT
FT                   AFHGARIPLTVTDLRDSEWRDDDGNTRRAVVATMTGTDSGTGEARVFTRSYEGRWRHRR
FT                   APALGAPYVAFVDDSGAIIIPA"
     MSEPEFDRER RAAARSVRES HLMVRLFIAL GVLTIAAGCY FTVVDTMFLA SASTAEGRVV        60
     DYEESASPKE NGRTEYSYQR IVGYTVDGVD YRKRESGASS SEPAIGDAVT VYYDPDDPQH       120
     AMIDAFMRKW LGPLAIIFGV LWTALFAAIQ RWTRRKQGER ERTAFHGARI PLTVTDLRDS       180
     EWRDDDGNTR RAVVATMTGT DSGTGEARVF TRSYEGRWRH RRAPALGAPY VAFVDDSGAI       240
     IIPA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page