(data stored in ACNUC1104 zone)

EMBL: CP001966.PE152

CP001966.PE152       Location/Qualifiers
FT   CDS             complement(155735..156154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76806"
FT                   /db_xref="GOA:D5UQ38"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76806.1"
FT                   /translation="MWIVRVGIALARPIGPQWDWRFLVIPTISALGLTAAVFNLPREAR
FT                   WTYAKPRLEATSAAIRSGAMPVRSGESLRIGSYSLSYDDRADGNIWFRVVDAGFLNSEY
FT                   LVHSPVGHAVRPAEERHRNTVEHFDGQWWLVNEVF"
     MWIVRVGIAL ARPIGPQWDW RFLVIPTISA LGLTAAVFNL PREARWTYAK PRLEATSAAI        60
     RSGAMPVRSG ESLRIGSYSL SYDDRADGNI WFRVVDAGFL NSEYLVHSPV GHAVRPAEER       120
     HRNTVEHFDG QWWLVNEVF                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page