(data stored in ACNUC1104 zone)

EMBL: CP001966.PE154

CP001966.PE154       Location/Qualifiers
FT   CDS             complement(156355..156942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_00790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76808"
FT                   /db_xref="GOA:D5UQ40"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76808.1"
FT                   /translation="MTTSASTALTPRAWWHRPPGLPLALASLIACGTWMVEASTPQDGS
FT                   PTLGVAILAGLSLIAFTWIGRTMISLAHRPRWSVRYAAVPLIGLITLGLVYLDVPFAAR
FT                   WIQAKPAFEHAAHAALADAQPTPTQLRLGTFSVTRSTVEGTVRFRLGTGAIGDTHYIVF
FT                   SPAGRPHTYGPPSEHDRVAHFDGPWWRVIDMY"
     MTTSASTALT PRAWWHRPPG LPLALASLIA CGTWMVEAST PQDGSPTLGV AILAGLSLIA        60
     FTWIGRTMIS LAHRPRWSVR YAAVPLIGLI TLGLVYLDVP FAARWIQAKP AFEHAAHAAL       120
     ADAQPTPTQL RLGTFSVTRS TVEGTVRFRL GTGAIGDTHY IVFSPAGRPH TYGPPSEHDR       180
     VAHFDGPWWR VIDMY                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page