(data stored in ACNUC1104 zone)

EMBL: CP001966.PE155

CP001966.PE155       Location/Qualifiers
FT   CDS             complement(156980..158038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76809"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76809.1"
FT                   /translation="MNSPRFPRNNRKRVDDYYGVHDTGMATQAPPQRPAAPPPQQPPPA
FT                   GPQPATPPAGAPSRGQQAPPPTAPQAPSQPRPEPRRPEPEQRSKPDPLNDPLTSETFLG
FT                   VQPESDTFEAGMFGYSASSRPAPSDVPPESNGFDSGFDQFAPPRFEPRAENGRQESTGS
FT                   AAEHEPVIDLADHPDGYIDVEVVDVVEVDHEPPPVRETLAIDAFPYTQIDESYVDPTVL
FT                   PEPKERGDMTDFNESLTEAMSIEGALGVALVDSQSGMALATAGDPKEFNLEVAAAGNSA
FT                   LVQAMSRTLGDLDLDDHIEDILITLGSQYQIVRPIRQGAEGLFLYLVLDRARANLAMAR
FT                   FRLTKLEEQIEV"
     MNSPRFPRNN RKRVDDYYGV HDTGMATQAP PQRPAAPPPQ QPPPAGPQPA TPPAGAPSRG        60
     QQAPPPTAPQ APSQPRPEPR RPEPEQRSKP DPLNDPLTSE TFLGVQPESD TFEAGMFGYS       120
     ASSRPAPSDV PPESNGFDSG FDQFAPPRFE PRAENGRQES TGSAAEHEPV IDLADHPDGY       180
     IDVEVVDVVE VDHEPPPVRE TLAIDAFPYT QIDESYVDPT VLPEPKERGD MTDFNESLTE       240
     AMSIEGALGV ALVDSQSGMA LATAGDPKEF NLEVAAAGNS ALVQAMSRTL GDLDLDDHIE       300
     DILITLGSQY QIVRPIRQGA EGLFLYLVLD RARANLAMAR FRLTKLEEQI EV               352
//

If you have problems or comments...

PBIL Back to PBIL home page