(data stored in ACNUC1104 zone)

EMBL: CP001966.PE157

CP001966.PE157       Location/Qualifiers
FT   CDS             159698..160468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0157"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: mab:MAB_0165 putative acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76811"
FT                   /db_xref="GOA:D5UQ43"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ43"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADG76811.1"
FT                   /translation="MEPIYGTIIKVARGMWAYQGIQFTEVDFQKFPREGGAVVAINHTG
FT                   YLDFPFAGKPADEAGHRKVRFMAKKEVFDNSKTGPLMRGCKHIPVDREAGAEAYAAAVD
FT                   ALKAGELVGVYPEATHSRSFELKGFKSGAARMAIEANVPIVPVVVWGAQQIWTKGLPKQ
FT                   LGRNKFRVLIGVCDPLDPVGPPDELTARLKGEMQTMLYQLQDLYGPHPQGAAWVPRRLG
FT                   GSAPTLEEADALDAADIEERRRRREERLGSGDDA"
     MEPIYGTIIK VARGMWAYQG IQFTEVDFQK FPREGGAVVA INHTGYLDFP FAGKPADEAG        60
     HRKVRFMAKK EVFDNSKTGP LMRGCKHIPV DREAGAEAYA AAVDALKAGE LVGVYPEATH       120
     SRSFELKGFK SGAARMAIEA NVPIVPVVVW GAQQIWTKGL PKQLGRNKFR VLIGVCDPLD       180
     PVGPPDELTA RLKGEMQTML YQLQDLYGPH PQGAAWVPRR LGGSAPTLEE ADALDAADIE       240
     ERRRRREERL GSGDDA                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page