(data stored in ACNUC1104 zone)

EMBL: CP001966.PE158

CP001966.PE158       Location/Qualifiers
FT   CDS             160461..161294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0158"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: mjl:Mjls_5404 Cof-like hydrolase; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3; Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76812"
FT                   /db_xref="GOA:D5UQ44"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ44"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADG76812.1"
FT                   /translation="MPDAELGERPVLVASDVDGTLVDEAEKISPRTHAALHAVRAAGGH
FT                   FVLATGRPPRAVDPIADQLDFAPLAVCANGAVLYDTGTSKVVSAALMSPDLLAHIAELV
FT                   YEHLPGAGFAAERVAQGEHDAATPRFAASTGYQHAWLEPETVSAEDAVVLSHPAVKLLV
FT                   RQPGMTSDEMHARVAPHLAGIADVTYATNNGLIEFHVPGVTKATGIRAAMRHLGLSDDV
FT                   RTAAFGDMPNDAEMLRWAGVGVAMANAHPVALDAANMVTSTNLDDGVAQILERWF"
     MPDAELGERP VLVASDVDGT LVDEAEKISP RTHAALHAVR AAGGHFVLAT GRPPRAVDPI        60
     ADQLDFAPLA VCANGAVLYD TGTSKVVSAA LMSPDLLAHI AELVYEHLPG AGFAAERVAQ       120
     GEHDAATPRF AASTGYQHAW LEPETVSAED AVVLSHPAVK LLVRQPGMTS DEMHARVAPH       180
     LAGIADVTYA TNNGLIEFHV PGVTKATGIR AAMRHLGLSD DVRTAAFGDM PNDAEMLRWA       240
     GVGVAMANAH PVALDAANMV TSTNLDDGVA QILERWF                                277
//

If you have problems or comments...

PBIL Back to PBIL home page