(data stored in ACNUC1104 zone)

EMBL: CP001966.PE159

CP001966.PE159       Location/Qualifiers
FT   CDS             complement(161328..161924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76813"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ45"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76813.1"
FT                   /translation="MPWERLDEFIDTMEYWTEVQNYLESIEAQRATGTRLVAFGRPYLK
FT                   DENTLILPNGPARDQMDDGEILLSITRDDDGYSLRRTGYERGDTFTGRQEWKASNFDLV
FT                   GKYVLVRQNSRFRTKIGVGSPFHQWLDIGLASQWEKRHMSQDEVGVDWLYKYTNSSSPS
FT                   VYYYDYDNGDPLTFPFSLSYRDITDIYMKGVPQPH"
     MPWERLDEFI DTMEYWTEVQ NYLESIEAQR ATGTRLVAFG RPYLKDENTL ILPNGPARDQ        60
     MDDGEILLSI TRDDDGYSLR RTGYERGDTF TGRQEWKASN FDLVGKYVLV RQNSRFRTKI       120
     GVGSPFHQWL DIGLASQWEK RHMSQDEVGV DWLYKYTNSS SPSVYYYDYD NGDPLTFPFS       180
     LSYRDITDIY MKGVPQPH                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page