(data stored in ACNUC1104 zone)

EMBL: CP001966.PE162

CP001966.PE162       Location/Qualifiers
FT   CDS             165933..167888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0162"
FT                   /product="putative galactofuranosyltransferase"
FT                   /note="KEGG: nfa:nfa1770 putative
FT                   galactofuranosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76816"
FT                   /db_xref="GOA:D5UQ48"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ48"
FT                   /inference="similar to AA sequence:KEGG:nfa1770"
FT                   /protein_id="ADG76816.1"
FT                   /translation="MSSTDTQAKTLLQRVILPRPGEPLDVRSLYLEEAETNSRRSHAPT
FT                   RTSLNIAGESEVSFATYFNAFPASYWRRWTVLKDVVLRIELKGTARVDLYRSKVDGARI
FT                   ALGGNLVETDATGYGVAEFATDLGPFEDGGWIWFDVTADSDTEIISAGWYATVSEEGLP
FT                   DKRVTVGIPTFNRPDDAVAAIRALTSDPLVDEVIDAVLMPDQGNKKVIDHPDYADAIAP
FT                   LGDRYQRFEQGNLGGSGGYGRIMYEALRLTDSPYVLYMDDDIAIEPDSILRALQFARFA
FT                   KTPMLVGGQMLNLQDRSHLHCMGEVIDRGAFMWTAAPFVEYDHDFSKYPLSDKENSKNL
FT                   HRRIDVDGNGWWMCLIPRVAAEEIGLPMPLFIKWDDWDYGLRAAEHGYPTATVPGIAIW
FT                   HMAWSDKDDAIDWQAYFHLRNRLVVAALHHEGSTRGIMSSSIKALMKHLLCLEYSTVAI
FT                   QIEAMRDFLRGPEALYELLPTALPKVAAMRKEYPDAVVLPSATELPRTTGAATALGTKI
FT                   PLNPITKVKTLAAAVRNNLRPADPHNHEVPQANYPPLEARWFSLGRVDGVTVTTADGRG
FT                   VVYRQRDREKMFALMRESLTVHREVDRRFEEMKQRYRAAYGDLTSREAWSKIFEPTTPG
FT                   AERAGRIEPENAGEQK"
     MSSTDTQAKT LLQRVILPRP GEPLDVRSLY LEEAETNSRR SHAPTRTSLN IAGESEVSFA        60
     TYFNAFPASY WRRWTVLKDV VLRIELKGTA RVDLYRSKVD GARIALGGNL VETDATGYGV       120
     AEFATDLGPF EDGGWIWFDV TADSDTEIIS AGWYATVSEE GLPDKRVTVG IPTFNRPDDA       180
     VAAIRALTSD PLVDEVIDAV LMPDQGNKKV IDHPDYADAI APLGDRYQRF EQGNLGGSGG       240
     YGRIMYEALR LTDSPYVLYM DDDIAIEPDS ILRALQFARF AKTPMLVGGQ MLNLQDRSHL       300
     HCMGEVIDRG AFMWTAAPFV EYDHDFSKYP LSDKENSKNL HRRIDVDGNG WWMCLIPRVA       360
     AEEIGLPMPL FIKWDDWDYG LRAAEHGYPT ATVPGIAIWH MAWSDKDDAI DWQAYFHLRN       420
     RLVVAALHHE GSTRGIMSSS IKALMKHLLC LEYSTVAIQI EAMRDFLRGP EALYELLPTA       480
     LPKVAAMRKE YPDAVVLPSA TELPRTTGAA TALGTKIPLN PITKVKTLAA AVRNNLRPAD       540
     PHNHEVPQAN YPPLEARWFS LGRVDGVTVT TADGRGVVYR QRDREKMFAL MRESLTVHRE       600
     VDRRFEEMKQ RYRAAYGDLT SREAWSKIFE PTTPGAERAG RIEPENAGEQ K                651
//

If you have problems or comments...

PBIL Back to PBIL home page