(data stored in ACNUC1104 zone)

EMBL: CP001966.PE166

CP001966.PE166       Location/Qualifiers
FT   CDS             171494..172405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0166"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: fal:FRAAL1683 putative zinc-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76820"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ52"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADG76820.1"
FT                   /translation="MTFAGRSIGFRNYGGPDVLVPLHDEKALDGPGRVLVRTAFSGVNP
FT                   VDVSFRIGRMDAFVGDIAAGFVPGMECCGEVVASSAPGLPVGRVVNALVLPGPAPRTGA
FT                   YAEFVQVDADRVGTVPAGLSPRAAACIPLNAVTASSILRSLDPAVETVVITGAAGALGR
FT                   FLVYASGAAGYRTIALARPGDEALLRGLGADDPVGDELRTPDVIIDAANLGAALSDRFT
FT                   SAGTVVRVRADTEYSLPHASLITATVREATDVAAHLDWWNGRIGGHPEVVGVVETFAPE
FT                   AAGAAQERLSVPGRRGRSALRW"
     MTFAGRSIGF RNYGGPDVLV PLHDEKALDG PGRVLVRTAF SGVNPVDVSF RIGRMDAFVG        60
     DIAAGFVPGM ECCGEVVASS APGLPVGRVV NALVLPGPAP RTGAYAEFVQ VDADRVGTVP       120
     AGLSPRAAAC IPLNAVTASS ILRSLDPAVE TVVITGAAGA LGRFLVYASG AAGYRTIALA       180
     RPGDEALLRG LGADDPVGDE LRTPDVIIDA ANLGAALSDR FTSAGTVVRV RADTEYSLPH       240
     ASLITATVRE ATDVAAHLDW WNGRIGGHPE VVGVVETFAP EAAGAAQERL SVPGRRGRSA       300
     LRW                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page