(data stored in ACNUC1104 zone)

EMBL: CP001966.PE175

CP001966.PE175       Location/Qualifiers
FT   CDS             182483..187597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0175"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase ; Acyl transferase;
FT                   Thioesterase; phosphopantetheine-binding; KEGG:
FT                   rha:RHA1_ro04065 polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76829"
FT                   /db_xref="GOA:D5UQJ6"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ6"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ADG76829.1"
FT                   /translation="MAENEYTPHEGPTGKAREDLSLEELRAWMRQWIADATKQPVENIT
FT                   DDKSLDEFGLGSRDAVSMASDIEDFTGVQLTATVAFQHPTIALLSQRIIDGDPVVSDDD
FT                   LAAEAAQYDRGEEFEANRGTHDVAVVGLATRFPKAGETPESTWEFLIGNGDATTDLPED
FT                   RWLEFKQDPRLKAVLDEANTFGGYLDDVASFDAEFFQMTPREVEMVDPQQRLALELTWE
FT                   ALEQANIPPSSVKGTRTGVWMGSSANDYQMLAVADPTKANPYALTGTSTSIVANRVSYF
FT                   YDFHGPSVAVDTACSSSLVAIHQAIRSLRDGETDMAVAGGVNMLIVPAATLGFDSLGAQ
FT                   APDGKIKAFSSDANGMIRAEGGGVVLLKRLADAERDGDDILGVIAGSAVTSDGKSNGIF
FT                   APNPEAQVINLRDAYIDAGIDPRTVDYLEAHGTGTILGDPLEADAIGRVLGRGRDAEKP
FT                   LLLGSAKTNFGHLEAAAGIAGVAKVLLSIRNGQIPASLNFAGPNPYIQFEANRLLMAAR
FT                   NTEWPRYSGHRIAGVTGNGFGGTNAHVVITEYIAPEIVEGETEADAADSADPNAVPEFY
FT                   AATADGVAVPLVLTAYVPSRRRAAAAELLEWLESDEATQYSLAEIGRTLASRNHGRVRS
FT                   VVLAKDLDEAIKGFRAIAEGKNAPNVISANQPDATGPAFIFSGFGSHHRKMAKQLYLEN
FT                   PVFKHYFDEVNELIIDESGDDYAEMITDDAQTFHIETGQVGIFAIQVALVGLFRHHGIE
FT                   PGVVLPHSMGEATAAWLTGGLSLEDAVRVICNRSRLMGEGEAMLPEEMERFMALVEYSA
FT                   DDIDTVLGEYEGLEICVYAAPTHTVIGGPGKVIDQIVAETEAKGLMARKLVTRGASHTS
FT                   QMDPLLGELQAELMGIEPHPLKYPMYSTVNKEEFYRAGHAPVHDVDYWIKGLRHSVWFT
FT                   QAVEKAVEAGYRTFIEFSPNPITLISVAAVTFGSGIQDAALVQTLKRKEDEPGTIMTAL
FT                   ATVFAHGHHVDVASLFGPGRYAPVPRTKFQRKHIWIQTKLPDGGSGMVPGAHVALPDGR
FT                   HVWQLDAGALTLGDQTRISLVDLAKNAAVQVLDGAAVTAAVEHGEAADGNTLTTTLTPH
FT                   PGGASIQVHENTGTGFRLLLDAVVVGGEASGSAAAPLITKAAPAAIADDADDALDAEPA
FT                   IAVSEETEAPAPEGSSTERWSPESGETVEHRLGVIIAETMGFEIEDLPKEIPLIDLGMD
FT                   SLIAMRIKNRAEYEFDIPPIQIQAVRDASFNDVVQFVEYAVEHRDQVDALAEHQSGTGE
FT                   MADAGKLAEMMQAAKDEAAAKASAPESAPESEPAAPSEPETGSDAPDLLDGAAVAEAIG
FT                   DGVPPRDAAERLTFATYAIVVGRSPGGVFNELDVLSEDVAEKLTARLSERAGGEVDIED
FT                   VIDSKNIEEMATYVGAVMNEATPVDGFVRTLRKPENTNRKPLFLFHPAGGNTTAYEALL
FT                   RKLPQDLPVYGFERVEGEVEDRVREYLPKLKQIQPEGPYRLAGWSLGGAFAYGLGRALE
FT                   DEGQQVEYIGLLDVVAPTVPLTDEPAEKKARLQRWETFARKNYDIGSEIELPMDRLEAA
FT                   DDEGQFKIIMELVQLSDKKVPTSMIEHQRTSFIDNRMLIKVNPADYGRFEGKVTLYRAD
FT                   RMHDGAVELEPNFADIAPDGGWAPVVEDLEIVKIGGDHLQIIDEPYIGKIATHMSAELE
FT                   RADAERS"
     MAENEYTPHE GPTGKAREDL SLEELRAWMR QWIADATKQP VENITDDKSL DEFGLGSRDA        60
     VSMASDIEDF TGVQLTATVA FQHPTIALLS QRIIDGDPVV SDDDLAAEAA QYDRGEEFEA       120
     NRGTHDVAVV GLATRFPKAG ETPESTWEFL IGNGDATTDL PEDRWLEFKQ DPRLKAVLDE       180
     ANTFGGYLDD VASFDAEFFQ MTPREVEMVD PQQRLALELT WEALEQANIP PSSVKGTRTG       240
     VWMGSSANDY QMLAVADPTK ANPYALTGTS TSIVANRVSY FYDFHGPSVA VDTACSSSLV       300
     AIHQAIRSLR DGETDMAVAG GVNMLIVPAA TLGFDSLGAQ APDGKIKAFS SDANGMIRAE       360
     GGGVVLLKRL ADAERDGDDI LGVIAGSAVT SDGKSNGIFA PNPEAQVINL RDAYIDAGID       420
     PRTVDYLEAH GTGTILGDPL EADAIGRVLG RGRDAEKPLL LGSAKTNFGH LEAAAGIAGV       480
     AKVLLSIRNG QIPASLNFAG PNPYIQFEAN RLLMAARNTE WPRYSGHRIA GVTGNGFGGT       540
     NAHVVITEYI APEIVEGETE ADAADSADPN AVPEFYAATA DGVAVPLVLT AYVPSRRRAA       600
     AAELLEWLES DEATQYSLAE IGRTLASRNH GRVRSVVLAK DLDEAIKGFR AIAEGKNAPN       660
     VISANQPDAT GPAFIFSGFG SHHRKMAKQL YLENPVFKHY FDEVNELIID ESGDDYAEMI       720
     TDDAQTFHIE TGQVGIFAIQ VALVGLFRHH GIEPGVVLPH SMGEATAAWL TGGLSLEDAV       780
     RVICNRSRLM GEGEAMLPEE MERFMALVEY SADDIDTVLG EYEGLEICVY AAPTHTVIGG       840
     PGKVIDQIVA ETEAKGLMAR KLVTRGASHT SQMDPLLGEL QAELMGIEPH PLKYPMYSTV       900
     NKEEFYRAGH APVHDVDYWI KGLRHSVWFT QAVEKAVEAG YRTFIEFSPN PITLISVAAV       960
     TFGSGIQDAA LVQTLKRKED EPGTIMTALA TVFAHGHHVD VASLFGPGRY APVPRTKFQR      1020
     KHIWIQTKLP DGGSGMVPGA HVALPDGRHV WQLDAGALTL GDQTRISLVD LAKNAAVQVL      1080
     DGAAVTAAVE HGEAADGNTL TTTLTPHPGG ASIQVHENTG TGFRLLLDAV VVGGEASGSA      1140
     AAPLITKAAP AAIADDADDA LDAEPAIAVS EETEAPAPEG SSTERWSPES GETVEHRLGV      1200
     IIAETMGFEI EDLPKEIPLI DLGMDSLIAM RIKNRAEYEF DIPPIQIQAV RDASFNDVVQ      1260
     FVEYAVEHRD QVDALAEHQS GTGEMADAGK LAEMMQAAKD EAAAKASAPE SAPESEPAAP      1320
     SEPETGSDAP DLLDGAAVAE AIGDGVPPRD AAERLTFATY AIVVGRSPGG VFNELDVLSE      1380
     DVAEKLTARL SERAGGEVDI EDVIDSKNIE EMATYVGAVM NEATPVDGFV RTLRKPENTN      1440
     RKPLFLFHPA GGNTTAYEAL LRKLPQDLPV YGFERVEGEV EDRVREYLPK LKQIQPEGPY      1500
     RLAGWSLGGA FAYGLGRALE DEGQQVEYIG LLDVVAPTVP LTDEPAEKKA RLQRWETFAR      1560
     KNYDIGSEIE LPMDRLEAAD DEGQFKIIME LVQLSDKKVP TSMIEHQRTS FIDNRMLIKV      1620
     NPADYGRFEG KVTLYRADRM HDGAVELEPN FADIAPDGGW APVVEDLEIV KIGGDHLQII      1680
     DEPYIGKIAT HMSAELERAD AERS                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page