(data stored in ACNUC1104 zone)

EMBL: CP001966.PE176

CP001966.PE176       Location/Qualifiers
FT   CDS             187610..189193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0176"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: rha:RHA1_ro04066
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76830"
FT                   /db_xref="GOA:D5UQJ7"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ7"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADG76830.1"
FT                   /translation="MADVTDVTEQVDTPDLHTTAGKLADLHRRLEAASDPGSERAKARR
FT                   DAKGLPSARQRMHMLFDEGTFVELDQLAKSPGDDKIKDGVVIGYGLVNGRKVAAFSHDQ
FT                   TVGAGTVGEMFGRKMVKLYDFAATAGLPVVGINDSGGARIQDAATSIAWYAELGRHQDG
FT                   LCGQVPQISMILGTCVGGAVYAPANTDVLVGVEDNTYMFVTGPEVIRPTTGEMTSAEDL
FT                   GGAVKQATWGNLHHVAKDEQAAFDWVKRYLGFMPDSVHQRPPLVNPGIEPELTDTDLSL
FT                   ESIIPDADNAGYDIHDVILRVFDDGDFLEYAELWAPNIVCGFARSDGQSVGVVANQPMH
FT                   MAGTLDTQASEKAARFVRLCNSFNIPLVFLVDVPGILPGVEEEKIGTIRRSGKFIFSYV
FT                   EAAVPKVTIILRKSYGGAWAVMGSKQLGADFVFAWPTARLAVMGAEGAAAIIKRREIEE
FT                   AGENGPAIRQAFIDFYNQFMATPWLAAERGYIDGVIEPRGTRLLIRKCLRQLQDKELQR
FT                   VPRRTYLMPM"
     MADVTDVTEQ VDTPDLHTTA GKLADLHRRL EAASDPGSER AKARRDAKGL PSARQRMHML        60
     FDEGTFVELD QLAKSPGDDK IKDGVVIGYG LVNGRKVAAF SHDQTVGAGT VGEMFGRKMV       120
     KLYDFAATAG LPVVGINDSG GARIQDAATS IAWYAELGRH QDGLCGQVPQ ISMILGTCVG       180
     GAVYAPANTD VLVGVEDNTY MFVTGPEVIR PTTGEMTSAE DLGGAVKQAT WGNLHHVAKD       240
     EQAAFDWVKR YLGFMPDSVH QRPPLVNPGI EPELTDTDLS LESIIPDADN AGYDIHDVIL       300
     RVFDDGDFLE YAELWAPNIV CGFARSDGQS VGVVANQPMH MAGTLDTQAS EKAARFVRLC       360
     NSFNIPLVFL VDVPGILPGV EEEKIGTIRR SGKFIFSYVE AAVPKVTIIL RKSYGGAWAV       420
     MGSKQLGADF VFAWPTARLA VMGAEGAAAI IKRREIEEAG ENGPAIRQAF IDFYNQFMAT       480
     PWLAAERGYI DGVIEPRGTR LLIRKCLRQL QDKELQRVPR RTYLMPM                     527
//

If you have problems or comments...

PBIL Back to PBIL home page