(data stored in ACNUC1104 zone)

EMBL: CP001966.PE177

CP001966.PE177       Location/Qualifiers
FT   CDS             189196..190545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0177"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="KEGG: rer:RER_51320 FAD-linked oxidase; PFAM: FAD
FT                   linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76831"
FT                   /db_xref="GOA:D5UQJ8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ8"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ADG76831.1"
FT                   /translation="MPSLESFPQLTGAVLTDPDVTAAYATDHCSPVFGAVPLAVVLAET
FT                   TEDVAAAARWCYANDVVMVPRGAGSGLAGGASAIEGCVIISLAKMDAILEINVADQYAR
FT                   AEAGVINAHLDAAAREVGLMYPPDPSSYEICSIGGNVATNAGGLRCVKYGVTREYVLGL
FT                   TVVLPDGRIITTGRRTVKGVTGYDLTQLLCGSEGTLGIVTEVTVKLRPAPLIAPTTVAA
FT                   SFPDVVSAASAVAAVVGTGVVPALMELMDRGTLECVEAMRPFGLEDETRAMLIGQGSTP
FT                   EDAAVLAREFDAAGAHYVVVSDDPAEAAELLSVRRAAFHAYEYAGNMFSEDVGVPRSKL
FT                   PEMFARIEEIAAKYQVAIPTCAHAGDGNLHPTLIYSRELTEVPQAIWDAADEVFQAALD
FT                   LGGTLTGEHGVGVLKARWVGDELSDDVLELHRGIKAVWDPKNLLNPGRGF"
     MPSLESFPQL TGAVLTDPDV TAAYATDHCS PVFGAVPLAV VLAETTEDVA AAARWCYAND        60
     VVMVPRGAGS GLAGGASAIE GCVIISLAKM DAILEINVAD QYARAEAGVI NAHLDAAARE       120
     VGLMYPPDPS SYEICSIGGN VATNAGGLRC VKYGVTREYV LGLTVVLPDG RIITTGRRTV       180
     KGVTGYDLTQ LLCGSEGTLG IVTEVTVKLR PAPLIAPTTV AASFPDVVSA ASAVAAVVGT       240
     GVVPALMELM DRGTLECVEA MRPFGLEDET RAMLIGQGST PEDAAVLARE FDAAGAHYVV       300
     VSDDPAEAAE LLSVRRAAFH AYEYAGNMFS EDVGVPRSKL PEMFARIEEI AAKYQVAIPT       360
     CAHAGDGNLH PTLIYSRELT EVPQAIWDAA DEVFQAALDL GGTLTGEHGV GVLKARWVGD       420
     ELSDDVLELH RGIKAVWDPK NLLNPGRGF                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page