(data stored in ACNUC1104 zone)

EMBL: CP001966.PE178

CP001966.PE178       Location/Qualifiers
FT   CDS             complement(190740..191225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0178"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: xfn:XfasM23_0503
FT                   putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76832"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ9"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ADG76832.1"
FT                   /translation="MSFSVPELSGSPAERYAELAGFASALIDGEPDRVANAANLSALVK
FT                   ATVPDLNWVGFYFFDGTELVVGPFQGLPACIRIPLDRGVCGAAARTGRTQRVDDVHAVA
FT                   DHIACDGATNSELVVPLVRDGELIGVFDLDSEKPARFTDDDQRGLEAIAAVYLDSLR"
     MSFSVPELSG SPAERYAELA GFASALIDGE PDRVANAANL SALVKATVPD LNWVGFYFFD        60
     GTELVVGPFQ GLPACIRIPL DRGVCGAAAR TGRTQRVDDV HAVADHIACD GATNSELVVP       120
     LVRDGELIGV FDLDSEKPAR FTDDDQRGLE AIAAVYLDSL R                           161
//

If you have problems or comments...

PBIL Back to PBIL home page