(data stored in ACNUC1104 zone)

EMBL: CP001966.PE179

CP001966.PE179       Location/Qualifiers
FT   CDS             191588..192571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0179"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: rop:ROP_50250
FT                   mycolyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76833"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK0"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADG76833.1"
FT                   /translation="MRMRNGWAKRATAAAITVAAIPALAGGIGSIGAANAWGPGNAKNP
FT                   PKGFKQAFVNGAGMPNVKVRSWASTTTDPKKAPTVVLLDGLRATWDVSGWERDSNVAFL
FT                   SQKGINVVTPVGGTSSWYADWQNPSSTNRQPYRYTWASFLKTSLPQYIRSLGFSDNVSL
FT                   IGLSMSGSAALINTIESNGYYKRAASLSGLVNISAPGIPIAVGIASLDSGGYNAGLDMW
FT                   GGPLDSRWAKNDPTVQVGRFKNIPLWISAGNGVFGKYTPNPGPADVIQGVPLEWLALSQ
FT                   ARSFEGATKRAGLTKTHFDFPPAGTHTWGYWQDQVWQMQRTGWFTK"
     MRMRNGWAKR ATAAAITVAA IPALAGGIGS IGAANAWGPG NAKNPPKGFK QAFVNGAGMP        60
     NVKVRSWAST TTDPKKAPTV VLLDGLRATW DVSGWERDSN VAFLSQKGIN VVTPVGGTSS       120
     WYADWQNPSS TNRQPYRYTW ASFLKTSLPQ YIRSLGFSDN VSLIGLSMSG SAALINTIES       180
     NGYYKRAASL SGLVNISAPG IPIAVGIASL DSGGYNAGLD MWGGPLDSRW AKNDPTVQVG       240
     RFKNIPLWIS AGNGVFGKYT PNPGPADVIQ GVPLEWLALS QARSFEGATK RAGLTKTHFD       300
     FPPAGTHTWG YWQDQVWQMQ RTGWFTK                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page