(data stored in ACNUC1104 zone)

EMBL: CP001966.PE18

CP001966.PE18        Location/Qualifiers
FT   CDS             21868..22077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_5098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76672"
FT                   /db_xref="GOA:D5UPC0"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC0"
FT                   /inference="similar to AA sequence:KEGG:MMAR_5098"
FT                   /protein_id="ADG76672.1"
FT                   /translation="MANLSTAHAGDLSLGISRRAVWLTVATLLAVLAYYFIGIDQGAVS
FT                   VFGNDTHIHEFFHDARHFLGFPCH"
     MANLSTAHAG DLSLGISRRA VWLTVATLLA VLAYYFIGID QGAVSVFGND THIHEFFHDA        60
     RHFLGFPCH                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page